GHRH(1-29) reference peptide
A 29-amino-acid synthetic peptide corresponding to the first 29 residues of native human GHRH. The canonical reference standard for GHRH receptor research.
| Compound | Sermorelin |
| Research category | GHRH / Secretagogue Research |
| Available sizes | 5mg, 10mg |
| Pricing | From £90 |
| Format | Lyophilised powder in sealed vial & pre-reconstituted pen |
| Purity | >99% by HPLC (Janoshik Analytical, batch-verified) |
| Intended use | In-vitro laboratory research only. Not for human consumption. |
Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.
| Compound class | Synthetic GHRH (1-29) analogue peptide |
| Molecular formula | C149H246N44O42S |
| Molecular weight | 3357.9 g/mol |
| CAS Registry Number | 86168-78-7 |
| PubChem CID | 16129617 |
| Number of residues | 29 |
| Amino acid sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Receptor / mechanism | GHRH receptor agonist (1-29 fragment of native GHRH). |
| Reported half-life | Reported ~10–20 minutes in human serum. |
| Solubility | Lyophilised powder reconstitutes in bacteriostatic water for laboratory use. |
| Storage (lyophilised) | Stable at 2–8 °C lyophilised for 24+ months. |
| Storage (reconstituted) | Reconstituted: store at 2–8 °C, use within 14 days. |
| Clinical / regulatory status | Approved historically; widely used in research. |
Sermorelin is a synthetic peptide corresponding to the first 29 amino acids of growth-hormone-releasing hormone (GHRH 1-29). Characterised in the literature as a GHRH receptor agonist. Supplied as lyophilised powder for in-vitro research use only.
The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans.
Sermorelin is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved - do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.
Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.
| State | Temperature | Shelf life |
|---|---|---|
| Lyophilised | 2–8 °C or −20 °C | Up to 24 months |
| Reconstituted | 2–8 °C | 4–6 weeks typical |
Every batch of Sermorelin we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik's records. Reported purity is consistently above 99%.
Researchers working with Sermorelin often work alongside the following compounds in the preclinical literature:
References are independent peer-reviewed sources. Lab77 Peptides is not affiliated with these publications.